Novus Biologicals
Manufacturer Code:NBP238520
Catalog # NBP238520
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: WSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: CD3-epsilon; CD3e; CD3e antigen CD3e antigen epsilon polypeptide (TiT3 complex) CD3e molecule epsilon (CD3-TCR complex) CD3-epsilon FLJ18683 T3E T-cell antigen receptor complex epsilon subunit of T3 T-cell surface antigen T3/Leu-4 epsilon chain T-cell surface glycoprotein CD3 epsilon chain TCRE; CD3e antigen, epsilon polypeptide (TiT3 complex); CD3e molecule, epsilon (CD3-TCR complex); T-cell antigen receptor complex, epsilon subunit of T3; T-cell surface antigen T3/Leu-4 epsilon chain; T-cell surface glycoprotein CD3 epsilon chain
Gene Aliases: CD3E; IMD18; T3E; TCRE
UniProt ID: (Human) P07766
Entrez Gene ID: (Human) 916
Molecular Function:
cytokine receptor
defense/immunity protein
immunoglobulin receptor superfamily
receptor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.