Novus Biologicals
Manufacturer Code:NBP238730
Catalog # NBP238730
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: YKEGTMLNCECKRGFRRIKSGSLYMLCTGNSSHSSWDNQCQCTSSATRNTTKQVTPQPEEQKERKTTEMQSPMQP |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: CD25; CD25 CD25 antigen IDDM10 IL-2 receptor subunit alpha IL2R IL-2R subunit alpha IL-2-RA IL2-RA interleukin 2 receptor alpha interleukin-2 receptor subunit alpha p55 TAC antigen TCGFR; IL-2 receptor subunit alpha; IL-2R subunit alpha; interleukin 2 receptor, alpha; Interleukin-2 receptor subunit alpha; p55; TAC antigen
Gene Aliases: CD25; IDDM10; IL2R; IL2RA; IMD41; p55; TCGFR
UniProt ID: (Human) P01589
Entrez Gene ID: (Human) 3559
Molecular Function:
cytokine receptor
receptor
type I cytokine receptor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.