Novus Biologicals
Manufacturer Code:NBP238895
Catalog # NBP238895
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: VIRYSCSGTFRLIGEKSLLCITKDKVDGTWDKPAPKCEYFNKYSSCPEPIVPGGYKIRGSTPYRHGDSVTFACKTNFSMNGNKS |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: C3DRSLEB9 CD21 CD21 antigen Complement C3d receptor complement component (3d/Epstein Barr virus) receptor 2 complement receptor type 2 Cr2 EBV receptor Epstein-Barr virus receptor; CD21; Complement C3d receptor; complement component (3d/Epstein Barr virus) receptor 2; Complement receptor type 2; Cr2; EBV receptor; Epstein-Barr virus receptor
Gene Aliases: C3DR; CD21; CR; CR2; CVID7; SLEB9
UniProt ID: (Human) P20023
Entrez Gene ID: (Human) 1380
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.