Novus Biologicals
Manufacturer Code:NBP156608
Catalog # NBP156608
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to CCT8(chaperonin containing TCP1 subunit 8 (theta)) The peptide sequence was selected from the C terminal of CCT8. Peptide sequence DMLEAGILDTYLGKYWAIKLATNAAVTVLRVDQIIMAKPAGGPKPPSGKK. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: C21orf112 CCTQ CCT-theta chaperonin containing TCP1 subunit 8 (theta) chromosome 21 open reading frame 112 D21S246 KIAA0002 PRED71 T-complex protein 1 subunit theta T-complex protein 1 theta subunit 10Renal carcinoma antigen NY-REN-15 TCP-1-theta; CCT-theta; Chaperonin containing T-complex polypeptide 1 subunit 8; chaperonin containing TCP1, subunit 8 (theta); Renal carcinoma antigen NY-REN-15; T-complex protein 1 subunit theta; TCP-1-theta
Gene Aliases: C21orf112; CCT8; CCTQ; D21S246; KIAA0002; PRED71
UniProt ID: (Human) P50990
Entrez Gene ID: (Human) 10694
Molecular Function: chaperone chaperonin
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.