Novus Biologicals
Manufacturer Code:NBP233583
Catalog # NBP233583
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: DVTGDGTTSNVLIIGELLKQADLYISEGLHPRIIAEGFEAAK |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: acute morphine dependence related protein 2; acute morphine dependence related protein 2 Acute morphine dependence-related protein 2 amino acid transport defect-complementing CCT6 Cctz CCT-zeta CCT-zeta-1 chaperonin containing T-complex subunit 6 chaperonin containing TCP1 subunit 6A (zeta 1) histidine transport regulator 3 HTR3MGC126215 MGC126214 MoDP-2 T-complex protein 1 subunit zeta T-complex protein 1 zeta subunit TCP-1-zeta TCP20 TCPZ TTCP20; Acute morphine dependence-related protein 2; amino acid transport defect-complementing; CCT-zeta-1; chaperonin containing T-complex subunit 6; chaperonin containing TCP1, subunit 6A (zeta 1); histidine transport regulator 3; HTR3; T-complex protein 1 subunit zeta; T-complex protein 1, zeta subunit; TCP-1-zeta; Tcp20
Gene Aliases: CCT-zeta; CCT-zeta-1; CCT6; CCT6A; CCTZ; HTR3; MoDP-2; TCP-1-zeta; TCP20; TCPZ; TTCP20
UniProt ID: (Human) P40227
Entrez Gene ID: (Human) 908
Molecular Function:
chaperone
chaperonin
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.