Invitrogen
Manufacturer Code:PA128319
Catalog # PIPA128319
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
ELISA (ELISA) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Chicken |
Class | Polyclonal |
Type | Antibody |
Immunogen | synthetic peptide GSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN corresponding to amino acids 27-92 of Human Macrophage Inflammatory Protein 1 beta. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4°C short term. For long term storage store at -20°C avoiding freeze/thaw cycles. |
Chicken Polyclonal Antibody
For Research Use Only
Protein Aliases: ACT-2; ACT2 AT744.1 G-26 LAG1 MGC104418 MGC126025 MGC126026 MIP-1-beta MIP1B MIP1B1 SCYA2 SCYA4; C-C motif chemokine 4; chemokine (C-C motif) ligand 4; G-26 T-lymphocyte-secreted protein; HC21; LAG-1; Lymphocyte activation gene 1 protein; Macrophage inflammatory protein 1-beta; MIP-1-beta; MIP-1-beta(1-69); MIP-1-beta(3-69); PAT 744; Protein H400; secreted protein G-26; SIS-gamma; small inducible cytokine A4 (homologous to mouse Mip-1b); Small-inducible cytokine A4; T-cell activation protein 2
Gene Aliases: ACT2; AT744.1; CCL4; G-26; HC21; LAG-1; LAG1; MIP-1-beta; MIP1B; MIP1B1; SCYA2; SCYA4
UniProt ID: (Human) P13236
Entrez Gene ID: (Human) 6351
Molecular Function: chemokine cytokine signaling molecule
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.