Novus Biologicals
Manufacturer Code:NBP179940
Catalog # NBP179940
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide directed towards the middle region of human CCL18. Peptide sequence PQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Alternative macrophage activation-associated CC chemokine 1; Alternative macrophage activation-associated CC chemokine 1 AMAC1CC chemokine ligand 18 AMAC-1Small-inducible cytokine A18 chemokine (C-C motif) ligand 18 (pulmonary and activation-regulated) CKb7 DC-CK1CC chemokine PARC DCCK1Macrophage inflammatory protein 4 Dendritic cell chemokine 1 MIP4 MIP-4C-C motif chemokine 18 PARCPulmonary and activation-regulated chemokine SCYA18chemokine (C-C) dendritic small inducible cytokine A18 small inducible cytokine subfamily A (Cys-Cys) member 18 pulmonary andactivation-regulated; AMAC-1; C-C motif chemokine 18; CC chemokine ligand 18; CC chemokine PARC; CCL18(1-68); CCL18(3-69); CCL18(4-69); chemokine (C-C motif) ligand 18 (pulmonary and activation-regulated); chemokine (C-C), dendritic; DC-CK1; Dendritic cell chemokine 1; Macrophage inflammatory protein 4; MIP-4; Pulmonary and activation-regulated chemokine; small inducible cytokine A18; small inducible cytokine subfamily A (Cys-Cys), member 18, pulmonary and activation-regulated; Small-inducible cytokine A18
Gene Aliases: AMAC-1; AMAC1; CCL18; CKb7; DC-CK1; DCCK1; MIP-4; MIP4; PARC; SCYA18
UniProt ID: (Human) P55774
Entrez Gene ID: (Human) 6362
Molecular Function:
chemokine
cytokine
signaling molecule
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.