Novus Biologicals
Manufacturer Code:NBP170487
Catalog # NBP170487
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to RP11-82K18.3 The peptide sequence was selected from the N terminal of RP11-82K18.3. Peptide sequence SGRAKFLKTISSSKILGFSTSAKMSLKFTNAKRIEGLDSNVWIEFTKLAA. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: cysteine conjugate beta lyase 2; cysteine conjugate-beta lyase 2; cysteine conjugate-beta lyase 2 Cysteine-S-conjugate beta-lyase 2 DKFZp547N1117 EC 2.6.1.63 EC 2.6.1.7 EC 4.4.1.13 KAT3DKFZp667D0223 KATIII Kynurenine aminotransferase III Kynurenine--glyoxylate transaminase kynurenine-oxoglutarate transaminase 3 kynurenine--oxoglutarate transaminase 3 Kynurenine--oxoglutarate transaminase III MGC9398 RBM1 RP11-82K18.3 RP4-531M19.2; Cysteine-S-conjugate beta-lyase 2; KATIII; Kynurenine aminotransferase 3; Kynurenine aminotransferase III; Kynurenine--glyoxylate transaminase; Kynurenine--oxoglutarate transaminase 3; Kynurenine--oxoglutarate transaminase III; kynurenine-oxoglutarate transaminase 3; RP11-82K18.3
Gene Aliases: CCBL2; KAT3; KATIII; KYAT3
UniProt ID: (Human) Q6YP21
Entrez Gene ID: (Human) 56267
Molecular Function:
transaminase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.