Novus Biologicals
Manufacturer Code:NBP179859
Catalog # NBP179859
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | The immunogen for this antibody is CBR4. Peptide sequence VGFSRALAKEVARKKIRVNVVAPGFVHTDMTKDLKEEHLKKNIPLGRFGE. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 3-ketoacyl-[acyl-carrier-protein] reductase beta subunit; 3-oxoacyl-[acyl-carrier-protein] reductase; 3-oxoacyl-[acyl-carrier-protein] reductase carbonic reductase 4 carbonyl reductase 4 carbonyl reductase family member 4 EC 1.1.1 EC 1.1.1.- EC 1.1.1.100 FLJ14431 Quinone reductase CBR4 SDR45C1 short chain dehydrogenase/reductase family 45C member 1; carbonic reductase 4; Carbonyl reductase family member 4; KAR beta subunit; Quinone reductase CBR4; Short chain dehydrogenase/reductase family 45C member 1; short chain dehydrogenase/reductase family 45C, member 1
Gene Aliases: CBR4; SDR45C1
UniProt ID: (Human) Q8N4T8
Entrez Gene ID: (Human) 84869
Molecular Function:
dehydrogenase
oxidoreductase
reductase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.