Novus Biologicals
Manufacturer Code:NBP187065
Catalog # NBP187065
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:DDPMPFDIKAEMTLKTNFFATRNMCNELLPIMKPHGRVVNISSLQCLRAFENCSEDLQERFHSETLTEGDLVDLMK |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: carbonyl reductase (NADPH) 3; carbonyl reductase (NADPH) 3 carbonyl reductase (NADPH) 3 EC 1.1.1.18410EC 1.1.1 carbonyl reductase [NADPH] 3 carbonyl reductase 3 EC 1.1.1.184 hCBR3 NADPH-dependent carbonyl reductase 3 SDR21C2 short chain dehydrogenase/reductase family 21C member 2; Carbonyl reductase [NADPH] 3; epididymis secretory protein Li 25; NADPH-dependent carbonyl reductase 3; Short chain dehydrogenase/reductase family 21C member 2; short chain dehydrogenase/reductase family 21C, member 2
Gene Aliases: CBR3; hCBR3; HEL-S-25; SDR21C2
UniProt ID: (Human) O75828
Entrez Gene ID: (Human) 874
Molecular Function:
dehydrogenase
oxidoreductase
reductase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.