Novus Biologicals
Manufacturer Code:NBP186595
Catalog # NBP186595
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:TPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQKFRSETITEEELVGLMNKFVE |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 15-hydroxyprostaglandin dehydrogenase; 15-hydroxyprostaglandin dehydrogenase [NADP(+)]; 15-hydroxyprostaglandin dehydrogenase [NADP+] carbonyl reductase (NADPH) 1 carbonyl reductase (NADPH) 1 EC 1.1.1.18410EC 1.1.1.19715-hydroxyprostaglandin dehydrogenase carbonyl reductase [NADPH] 1 carbonyl reductase 1 CBR CRN EC 1.1.1.184 EC 1.1.1.189 hCBR1 NADPH-dependent carbonyl reductase 1 Prostaglandin 9-ketoreductase Prostaglandin-E(2) 9-reductase SDR21C1 short chain dehydrogenase/reductase family 21C member 1; 20-beta-hydroxysteroid dehydrogenase; carbonyl reductase (NADPH) 1; Carbonyl reductase [NADPH] 1; NADPH-dependent carbonyl reductase 1; PG-9-KR; Prostaglandin 9-ketoreductase; Prostaglandin-E(2) 9-reductase; Short chain dehydrogenase/reductase family 21C member 1; short chain dehydrogenase/reductase family 21C, member 1
Gene Aliases: CBR; CBR1; CRN; hCBR1; SDR21C1
UniProt ID: (Human) P16152
Entrez Gene ID: (Human) 873
Molecular Function:
dehydrogenase
oxidoreductase
reductase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.