Novus Biologicals
Manufacturer Code:NBP152872
Catalog # NBP152872
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to CBR1(carbonyl reductase 1) The peptide sequence was selected from the C terminal of CBR1 (NP_001748). Peptide sequence PGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 15-hydroxyprostaglandin dehydrogenase; 15-hydroxyprostaglandin dehydrogenase [NADP(+)]; 15-hydroxyprostaglandin dehydrogenase [NADP+] carbonyl reductase (NADPH) 1 carbonyl reductase (NADPH) 1 EC 1.1.1.18410EC 1.1.1.19715-hydroxyprostaglandin dehydrogenase carbonyl reductase [NADPH] 1 carbonyl reductase 1 CBR CRN EC 1.1.1.184 EC 1.1.1.189 hCBR1 NADPH-dependent carbonyl reductase 1 Prostaglandin 9-ketoreductase Prostaglandin-E(2) 9-reductase SDR21C1 short chain dehydrogenase/reductase family 21C member 1; 20-beta-hydroxysteroid dehydrogenase; carbonyl reductase (NADPH) 1; Carbonyl reductase [NADPH] 1; NADPH-dependent carbonyl reductase 1; PG-9-KR; Prostaglandin 9-ketoreductase; Prostaglandin-E(2) 9-reductase; Short chain dehydrogenase/reductase family 21C member 1; short chain dehydrogenase/reductase family 21C, member 1
Gene Aliases: CBR; CBR1; CRN; hCBR1; SDR21C1
UniProt ID: (Human) P16152
Entrez Gene ID: (Human) 873
Molecular Function:
dehydrogenase
oxidoreductase
reductase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.