Novus Biologicals
Manufacturer Code:NBP174144
Catalog # NBP174144
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to the middle region of Slc7a3. Immunizing peptide sequence RAWSSAFDNLIGNHISRTLKGTILLKMPHVLAEYPDFFALALVLLLTGLL. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ATRC3cationic amino acid transporter 3 CAT3 CAT-3Cationic amino acid transporter y+ FLJ14541 MGC20687 solute carrier family 7 (cationic amino acid transporter y+ system) member 3 Solute carrier family 7 member 3; CAT-3; Cationic amino acid transporter 3; Cationic amino acid transporter y+; solute carrier family 7 (cationic amino acid transporter, y+ system), member 3; Solute carrier family 7 member 3
Gene Aliases: ATRC3; CAT-3; CAT3; SLC7A3
UniProt ID: (Human) Q8WY07
Entrez Gene ID: (Human) 84889
Molecular Function:
amino acid transporter
transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.