Novus Biologicals
Manufacturer Code:NBP190066
Catalog # NBP190066
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:QPNLVYQMASTSDELDPADQNELASTNDSQLGFLPEAEMFSLKTILSPKNMEPSKISGLIV |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: amino acid transporter cationic 1 ATRC1ERR CAT-1System Y+ basic amino acid transporter Ecotropic retroviral leukemia receptor homolog ecotropic retroviral receptor Ecotropic retrovirus receptor homolog HCAT1 high affinity cationic amino acid transporter 1 REC1LCAT1 solute carrier family 7 (cationic amino acid transporter y+ system) member 1 Solute carrier family 7 member 1; amino acid transporter, cationic 1; CAT-1; CAT1; Ecotropic retroviral leukemia receptor homolog; ecotropic retroviral receptor; Ecotropic retrovirus receptor homolog; High affinity cationic amino acid transporter 1; solute carrier family 7 (cationic amino acid transporter, y+ system), member 1; Solute carrier family 7 member 1; System Y+ basic amino acid transporter
Gene Aliases: ATRC1; CAT-1; ERR; HCAT1; REC1L; SLC7A1
UniProt ID: (Human) P30825
Entrez Gene ID: (Human) 6541
Molecular Function:
amino acid transporter
transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.