Novus Biologicals
Manufacturer Code:NBP154935
Catalog # NBP154935
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to NR1I3(nuclear receptor subfamily 1 group I member 3) The peptide sequence was selected from the middle region of NR1I3 (NP_001070939). Peptide sequence PVFRSLPIEDQISLLKGAAVEICHIVLNTTFCLQTQNFLCGPLRYTIEDG. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: CAR; CARCAR1 Constitutive activator of retinoid response constitutive active receptor Constitutive active response Constitutive androstane receptor MB67 MGC150433 MGC97144 MGC97209 nuclear receptor subfamily 1 group I member 3 nuclear receptor subfamily 1 group I member 3 orphan nuclear hormone receptor Orphan nuclear receptor MB67; Constitutive activator of retinoid response; constitutive active receptor; Constitutive active response; constitutive androstane nuclear receptor variant 2; constitutive androstane nuclear receptor variant 3; constitutive androstane nuclear receptor variant 4; constitutive androstane nuclear receptor variant 5; Constitutive androstane receptor; Nuclear receptor subfamily 1 group I member 3; nuclear receptor subfamily 1, group I, member 3; orphan nuclear hormone receptor; Orphan nuclear receptor MB67
Gene Aliases: CAR; CAR1; MB67; NR1I3
UniProt ID: (Human) Q14994
Entrez Gene ID: (Human) 9970
Molecular Function:
nuclear hormone receptor
nucleic acid binding
receptor
transcription factor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.