Novus Biologicals
Manufacturer Code:NBP181501
Catalog # NBP181501
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:EAWAEKFKVLASNRTHQDQPQKCGPNSHCEMDCEVNNEDLLCVLIDDGGFLVLSNQNHQWDQVGRFFSEVDANLMLALYN |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: alpha 2 delta calcium channel subunit; alpha 2 delta calcium channel subunit CACNA2D calcium channel voltage-dependent alpha 2/delta subunit 2 gene 26 KIAA0558Voltage-gated calcium channel subunit alpha-2/delta-2 LUAC11.1 voltage-dependent calcium channel subunit alpha-2/delta-2; calcium channel, voltage-dependent, alpha 2/delta subunit 2; gene 26; Voltage-dependent calcium channel subunit alpha-2-2; Voltage-dependent calcium channel subunit alpha-2/delta-2; Voltage-dependent calcium channel subunit delta-2; Voltage-gated calcium channel subunit alpha-2/delta-2
Gene Aliases: CACNA2D; CACNA2D2; KIAA0558
UniProt ID: (Human) Q9NY47
Entrez Gene ID: (Human) 9254
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.