Novus Biologicals
Manufacturer Code:NBP18010520UL
Catalog # NBP18010520
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide directed towards the middle region of human CACNA1G (NP_938202). Peptide sequence VSRTHSLPNDSYMCRHGSTAEGPLGHRGWGLPKAQSGSVLSVHSQPADTS. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: calcium channel voltage-dependent T type alpha 1G subunit cav3.1c KIAA1123 voltage-dependent calcium channel alpha 1G subunit voltage-dependent T-type calcium channel subunit alpha-1G voltage-dependent alpha 1G subunit voltage-dependent T type alpha-1G subunit; calcium channel, voltage-dependent, T type, alpha 1G subunit; Cav3.1c; NBR13; voltage-dependent calcium channel alpha 1G subunit, isoform 11; voltage-dependent T-type calcium channel alpha 1G subunit; Voltage-dependent T-type calcium channel subunit alpha-1G; Voltage-gated calcium channel subunit alpha Cav3.1
Gene Aliases: Ca(V)T.1; CACNA1G; Cav3.1; KIAA1123; NBR13; SCA42
UniProt ID: (Human) Q19R12
Entrez Gene ID: (Human) 8913
Molecular Function: calcium channel ion channel sodium channel transporter voltage-gated calcium channel voltage-gated ion channel voltage-gated sodium channel
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.