Novus Biologicals
Manufacturer Code:NBP258555
Catalog # NBP258555
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RDILTQGKDGVALKCEESGKEAKQAEMQLLVVHLSGSFEVISGRLLKREGH |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: bA522I20.2 C9orf103 chromosome 9 open reading frame 103 EC 2.7.1.12 glucokinase-like protein Gluconate kinase gluconokinase-like protein idnK gluconokinase homolog (E. coli) probable gluconokinase; glucokinase-like protein; Gluconate kinase; gluconokinase-like protein; idnK, gluconokinase homolog; Probable gluconokinase
Gene Aliases: bA522I20.2; C9orf103; hGntK; IDNK
UniProt ID: (Human) Q5T6J7
Entrez Gene ID: (Human) 414328
Molecular Function: transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.