Novus Biologicals
Manufacturer Code:NBP198263
Catalog # NBP198263
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | The immunogen for this antibody is UPF0539 protein C7orf59 N-terminal region. Peptide sequence MTSALTQGLERIPDQLGYLVLSEGAVLASSGDLENDEQAASAISELVSTA. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: C7orf59 chromosome 7 open reading frame 59 hypothetical protein LOC389541 late endosomal/lysosomal adaptor MAPK and MTOR activator 4 MGC163425 MGC163431; Late endosomal/lysosomal adaptor and MAPK and MTOR activator 4; Ragulator complex protein LAMTOR4; Ragulator complex protein LAMTOR4, N-terminally processed; UPF0539 protein C7orf59
Gene Aliases: C7orf59; LAMTOR4
UniProt ID: (Human) Q0VGL1
Entrez Gene ID: (Human) 389541
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.