Novus Biologicals
Manufacturer Code:NBP17046120UL
Catalog # NBP1704620
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to C20ORF160 The peptide sequence was selected from the N terminal of C20ORF160. Peptide sequence LTWVTSSLNPSSRDELLQLLDTARQLKELPLKTTAEQDSILSLSARCLLL. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: CCM2-like; cerebral cavernous malformation 2-like; Cerebral cavernous malformations 2 protein-like; chromosome 20 open reading frame 160 dJ310O13.5
Gene Aliases: C20orf160; CCM2L; dJ310O13.5
UniProt ID: (Human) Q9NUG4
Entrez Gene ID: (Human) 140706
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.