Novus Biologicals
Manufacturer Code:NBP16229620UL
Catalog # NBP16229620
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to C1QTNF1(C1q and tumor necrosis factor related protein 1) The peptide sequence was selected from the N terminal of C1QTNF1. Peptide sequence YPATAVPQINITILKGEKGDRGDRGLQGKYGKTGSAGARGHTGPKGQKGS. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: C1q and tumor necrosis factor related protein 1 CTRP1G protein-coupled receptor-interacting protein FLJ90694 G protein coupled receptor interacting protein GIPcomplement C1q tumor necrosis factor-related protein 1 ZSIG37; Complement C1q tumor necrosis factor-related protein 1; G protein coupled receptor interacting protein; G protein-coupled receptor-interacting protein; GIP
Gene Aliases: C1QTNF1; CTRP1; GIP; UNQ310/PRO353; ZSIG37
UniProt ID: (Human) Q9BXJ1
Entrez Gene ID: (Human) 114897
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.