Novus Biologicals
Manufacturer Code:NBP17950820UL
Catalog # NBP17950820
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide directed towards the middle region of human C1orf51The immunogen for this antibody is C1orf51. Peptide sequence GRFERGLSSFQQSVAMDRIQRIVGVLQKPQMGERYLGTLLQVEGMLKTWF. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: BC017397 chromosome 1 open reading frame 51 FLJ25889 hypothetical protein LOC148523; ChIP-derived repressor of network oscillator; Chrono; Circadian-associated transcriptional repressor; Computationally highlighted repressor of the network oscillator
Gene Aliases: C1orf51; CHRONO; CIART; GM129
UniProt ID: (Human) Q8N365
Entrez Gene ID: (Human) 148523
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.