Novus Biologicals
Manufacturer Code:NBP16259620UL
Catalog # NBP16259620
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to C1GALT1(core 1 synthase glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1) The peptide sequence was selected form the middle region of C1GALT1. Peptide sequence NVEAGDSRDTIGKETFHPFVPEHHLIKGYLPRTFWYWNY |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: B3Gal-T8; B3Gal-T8 Beta-13-galactosyltransferase C1GALT C1GalT1 Core 1 beta13-galactosyltransferase 1 Core 1 beta3-Gal-T1 Core 1 O-glycan T-synthase core 1 synthase glycoprotein-N-acetylgalactosamine3-beta-galactosyltransferase 1 Core 1 UDP-galactose:N-acetylgalactosamine-alpha-R beta13-galactosyltransferase 1 EC 2.4.1.122 glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 T-synthase; Beta-1,3-galactosyltransferase; C1GalT1; Core 1 beta1,3-galactosyltransferase 1; core 1 beta3-Gal-T1; Core 1 O-glycan T-synthase; core 1 synthase, glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase, 1; Core 1 UDP-galactose:N-acetylgalactosamine-alpha-R beta 1,3-galactosyltransferase 1; Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1
Gene Aliases: C1GALT; C1GALT1; T-synthase
UniProt ID: (Human) Q9NS00
Entrez Gene ID: (Human) 56913
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.