Novus Biologicals
Manufacturer Code:NBP17044020UL
Catalog # NBP17044020
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to C16orf73 (chromosome 16 open reading frame 73) The peptide sequence was selected from the middle region of C16orf73. Peptide sequence CSLTGSVAEETLGCTFVLSHRARSGLKISVLSCKLADPTEASRNLSGQKH. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: C16orf73 chromosome 16 open reading frame 73 gs129 meiosis specific with OB domains; Meiosis-specific with OB domain-containing protein
Gene Aliases: C16orf73; gs129; MEIOB
UniProt ID: (Human) Q8N635
Entrez Gene ID: (Human) 254528
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.