Novus Biologicals
Manufacturer Code:NBP191468
Catalog # NBP191468
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | The specific Immunogen is proprietary information. Peptide sequence RYYVLYIQPSCIHRRKFDPKGNEIEPNFSATRKVNTGFLMSSYKVEAKGD. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 2610034B18Rik RIKEN cDNA 2610034B18 gene; Arp2/3 inhibition protein; Arpin; UPF0552 protein C15orf38
Gene Aliases: ARPIN; C15orf38
UniProt ID: (Human) Q7Z6K5
Entrez Gene ID: (Human) 348110
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.