Novus Biologicals
Manufacturer Code:NBP159044
Catalog # NBP159044
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to BDKRB2(bradykinin receptor B2) The peptide sequence was selected from the N terminal of BDKRB2. Peptide sequence MFSPWKISMFLSVREDSVPTTASFSADMLNVTLQGPTLNGTFAQSKCPQV. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: B2 bradykinin receptor; B2 bradykinin receptor B2R BK2 BK-2 BK-2 receptor BKR2 bradykinin receptor B2 BRB2 DKFZp686O088; B2R; BK-2 receptor
Gene Aliases: B2R; BDKRB2; BK-2; BK2; BKR2; BRB2
UniProt ID: (Human) P30411
Entrez Gene ID: (Human) 624
Molecular Function:
G-protein coupled receptor
receptor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.