Novus Biologicals
Manufacturer Code:NBP157016
Catalog # NBP157016
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to FUT1 (fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase H blood group)) The peptide sequence was selected from the middle region of FUT1 (NP_000139). Peptide sequence EATPWKDFALLTQCNHTIMTIGTFGFWAAYLAGG |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 2-alpha-L-fucosyltransferase; alpha (1,2) fucosyltransferase; alpha (12) fucosyltransferase Alpha(12)FT 12-alpha-L-fucosyltransferase Blood group H alpha 2-fucosyltransferase EC 2.4.1.69 Fucosyltransferase 1 fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase) fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase Bombayphenotype included) fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase H blood group) galactoside 2-alpha-L-fucosyltransferase 1 GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase 1 HHH HSC; alpha(1,2) fucosyltransferase 1; Alpha(1,2)FT 1; Blood group H alpha 2-fucosyltransferase; Fucosyltransferase 1; fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase); fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase, H blood group); Galactoside alpha-(1,2)-fucosyltransferase 1; GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase 1; Type 1 galactoside alpha-(1,2)-fucosyltransferase FUT1; Type 2 galactoside alpha-(1,2)-fucosyltransferase FUT1
Gene Aliases: FUT1; H; HH; HSC
UniProt ID: (Human) P19526
Entrez Gene ID: (Human) 2523
Molecular Function:
glycosyltransferase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.