Novus Biologicals
Manufacturer Code:NBP156481
Catalog # NBP156481
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to AP2B1(adaptor-related protein complex 2 beta 1 subunit) The peptide sequence was selected from the middle region of AP2B1. Peptide sequence SETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVTAKEVVLSEKP. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: adapter-related protein complex 2 beta subunit; Adapter-related protein complex 2 beta subunit Adaptor protein complex AP-2 subunit beta adaptor-related protein complex 2 beta 1 subunit ADTB2adaptin beta 2 (beta) AP105B AP2-BETA Beta-2-adaptin Beta-adaptin CLAPB1AP-2 complex subunit beta Clathrin assembly protein complex 2 beta large chain clathrin-associated/assembly/adaptor protein large beta 1 DKFZp781K0743 Plasma membrane adaptor HA2/AP2 adaptin beta subunit; adapter-related protein complex 2 subunit beta; adaptin, beta 2 (beta); Adaptor protein complex AP-2 subunit beta; adaptor related protein complex 2, beta 1 subunit; Adaptor-related protein complex 2 subunit beta; adaptor-related protein complex 2, beta 1 subunit; AP-2 complex subunit beta; AP105B; Beta-2-adaptin; Beta-adaptin; Clathrin assembly protein complex 2 beta large chain; clathrin-associated/assembly/adaptor protein, large, beta 1; Plasma membrane adaptor HA2/AP2 adaptin beta subunit; testicular tissue protein Li 22
Gene Aliases: ADTB2; AP105B; AP2-BETA; AP2B1; CLAPB1
UniProt ID: (Human) P63010
Entrez Gene ID: (Human) 163
Molecular Function: membrane traffic protein
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.