Novus Biologicals
Manufacturer Code:NBP257127
Catalog # NBP257127
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:AQMYSGSSALHSASGRGLLPLVRTLVRSGADSSLKNCHNDTPLMVARSRRVIDILRGKATRPASTSQPDPSPDRSANTSPESSSRLSSN |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: B-cell CLL/lymphoma 3 B-cell leukemia/lymphoma 3 B-cell lymphoma 3 protein B-cell lymphoma 3-encoded protein BCL-3 BCL4 chronic lymphatic leukemia protein D19S37 Proto-oncogene BCL3; B-cell leukemia/lymphoma 3; B-cell lymphoma 3 protein; B-cell lymphoma 3-encoded protein; BCL-3; chronic lymphatic leukemia protein; Proto-oncogene BCL3
Gene Aliases: BCL3; BCL4; D19S37
UniProt ID: (Human) P20749
Entrez Gene ID: (Human) 602
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.