Novus Biologicals
Manufacturer Code:NBP239070
Catalog # NBP239070
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LIQYVNNEGFSAVEDGVLTQRVLLGDVSTEAARTFLHYLYTADTGLPPGLSSELSSLAHRFGVSELVHLCEQVPIATDSEGKPWEEKEAENCESRA |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: BTB (POZ) domain containing 12; BTB (POZ) domain containing 12 BTB/POZ domain-containing protein 12 BTBD12structure-specific endonuclease subunit SLX4 KIAA1784MUS312 KIAA1987FANCP SLX4 structure-specific endonuclease subunit homolog (S. cerevisiae); BTB/POZ domain-containing protein 12; SLX4 structure-specific endonuclease subunit homolog; Structure-specific endonuclease subunit SLX4
Gene Aliases: BTBD12; FANCP; KIAA1784; KIAA1987; MUS312; SLX4
UniProt ID: (Human) Q8IY92
Entrez Gene ID: (Human) 84464
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.