Novus Biologicals
Manufacturer Code:NBP189932
Catalog # NBP189932
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:MYIKMATLANGQADNASLSTNGLGSSPGSAGHMNGLSHSPGNPSTIPMKDH |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Bruno (Drosophila) -like 4 RNA binding protein BRUNOL-4 BRUNOL4Bruno -like 4 RNA binding protein bruno-like 4 RNA binding protein bruno-like 4 RNA binding protein (Drosophila) Bruno-like protein 4 CELF-4 CUG-BP and ETR-3 like factor 4 CUG-BP- and ETR-3-like factor 4 CUGBP Elav-like family member 4 CUGBP Elav-like family member 4 LYST-interacting protein LIP9 RNA-binding protein BRUNOL4 RNA-binding protein BRUNOL-4; bruno-like 4, RNA binding protein; Bruno-like protein 4; CELF-4; CUG-BP and ETR-3 like factor 4; CUG-BP- and ETR-3-like factor 4; CUGBP Elav-like family member 4; LYST-interacting protein LIP9; RNA-binding protein BRUNOL-4; RNA-binding protein BRUNOL4
Gene Aliases: BRUNOL4; CELF-4; CELF4
UniProt ID: (Human) Q9BZC1
Entrez Gene ID: (Human) 56853
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.