Novus Biologicals
Manufacturer Code:NBP190067
Catalog # NBP190067
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:KIWVLTGDKKETAENIGFACELLTEDTTICYGEDINSLLHARMENQRNRGGVYAKFAPPVQESFFPPGGNRALII |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: ATPase class I type 8B member 1; ATPase class I type 8B member 1 ATPase aminophospholipid transporter class I type 8B member 1 ATPase class I type 8B member 1 ATPICPFIC1 BRIC EC 3.6.3 EC 3.6.3.1 Familial intrahepatic cholestasis type 1 FIC1phospholipid-transporting ATPase IC PFICE1-E2 ATPase probable phospholipid-transporting ATPase IC; ATPase, aminophospholipid transporter, class I, type 8B, member 1; ATPase, class I, type 8B, member 1; E1-E2 ATPase; Familial intrahepatic cholestasis type 1; P4-ATPase flippase complex alpha subunit ATP8B1; Phospholipid-transporting ATPase IC; probable phospholipid-transporting ATPase IC
Gene Aliases: ATP8B1; ATPIC; BRIC; FIC1; ICP1; PFIC; PFIC1
UniProt ID: (Human) O43520
Entrez Gene ID: (Human) 5205
Molecular Function: cation transporter hydrolase transporter
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.