Novus Biologicals
Manufacturer Code:NBP180294
Catalog # NBP180294
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide directed towards the N terminal of human BRDT. Peptide sequence MSLPSRQTAIIVNPPPPEYINTKKNGRLTNQLQYLQKVVLKDLWKHSFSW. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Bromodomain testis-specific protein; bromodomain testis-specific protein bromodomain testis-specific Cancer/testis antigen 9 CT9BRD6 RING3-like protein; bromodomain, testis-specific; Cancer/testis antigen 9; CT9; RING3-like protein
Gene Aliases: BRD6; BRDT; CT9
UniProt ID: (Human) Q58F21
Entrez Gene ID: (Human) 676
Molecular Function:
DNA binding protein
acetyltransferase
chromatin/chromatin-binding protein
nucleic acid binding
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.