Novus Biologicals
Manufacturer Code:NBP15318620UL
Catalog # NBP15318620
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to BPGM(23-bisphosphoglycerate mutase) The peptide sequence was selected from the C terminal of BPGM. Peptide sequence LPTGVPILLELDENLRAVGPHQFLGDQEAIQAAIKKVEDQGKVKQAKK. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 2,3-bisphosphoglycerate mutase; 2,3-bisphosphoglycerate mutase, erythrocyte; 2,3-bisphosphoglycerate synthase; 2,3-diphosphoglycerate mutase; 23-bisphosphoglycerate mutase bisphosphoglycerate mutase BPG-dependent PGAM EC 3.1.3.1323-bisphosphoglycerate synthase EC 5.4.2.1 EC 5.4.2.4 erythrocyte 23-bisphosphoglycerate mutase23-bisphosphoglycerate mutase erythrocyte; Bisphosphoglycerate mutase; BPG-dependent PGAM; BPGM; DPGM; erythrocyte 2,3-bisphosphoglycerate mutase; testis secretory sperm-binding protein Li 202a
Gene Aliases: BPGM; DPGM
UniProt ID: (Human) P07738
Entrez Gene ID: (Human) 669
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.