Novus Biologicals
Manufacturer Code:NBP17950220UL
Catalog # NBP17950220
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptide directed towards the middle region of human BNIPLThe immunogen for this antibody is BNIPL. Peptide sequence AENYLLVHLSGGTSRAQVPPLSWIRQCYRTLDRRLRKNLRALVVVHATWY. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Bcl-2/adenovirus E1B 19 kDa-interacting protein 2-like protein; bcl-2/adenovirus E1B 19 kDa-interacting protein 2-like protein BCL2/adenovirus E1B 19kD interacting protein like BNIP-2 similar BNIPl-1 BNIPL-2 BNIP-S PP753; BCL2/adenovirus E1B 19kD interacting protein like; BNIP-2 similar
Gene Aliases: BNIP-S; BNIP-Salpha; BNIP-Sbeta; BNIPL; BNIPL-1; BNIPL-2; BNIPL1; BNIPL2; BNIPS; PP753
UniProt ID: (Human) Q7Z465
Entrez Gene ID: (Human) 149428
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.