Novus Biologicals
Manufacturer Code:NBP257759
Catalog # NBP257759
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GSTDNESCTNSELNSPLVRRTLPVLLLYSIKESDEKAGKIFSQMNNIMSKSLHDDGFTVPQIIEMELDSQEQLLLQDPPVTYIQQFADAA |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: APOLLON; APOLLON baculoviral IAP repeat containing 6 baculoviral IAP repeat-containing 6 baculoviral IAP repeat-containing protein 6 BRUCE FLJ13786 KIAA1289FLJ13726 Ubiquitin-conjugating BIR domain enzyme apollon ubiquitin-conjugating BIR-domain enzyme apollon; baculoviral IAP repeat-containing 6; Baculoviral IAP repeat-containing protein 6; BIR repeat-containing ubiquitin-conjugating enzyme; BRUCE; RING-type E3 ubiquitin transferase BIRC6; Ubiquitin-conjugating BIR domain enzyme apollon; ubiquitin-conjugating BIR-domain enzyme apollon
Gene Aliases: APOLLON; BIRC6; BRUCE; KIAA1289
UniProt ID: (Human) Q9NR09
Entrez Gene ID: (Human) 57448
Molecular Function: enzyme modulator protease inhibitor
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.