Novus Biologicals
Manufacturer Code:NBP232713
Catalog # NBP232713
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: EGAKVIATDINESKLQELEKYPGIQTRVLDVTKKKQIDQFANEVERLDVLFNVAGFVHHGTVLDCEEKDWDFS |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 3-hydroxybutyrate dehydrogenase type 2; 3-hydroxybutyrate dehydrogenase type 2 dehydrogenase/reductase (SDR family) member 6 Dehydrogenase/reductase SDR family member 6 DHRS6 EC 1.1.1.- EC 1.1.1.30 EFA6R FLJ13261 Oxidoreductase UCPA PRO20933 R-beta-hydroxybutyrate dehydrogenase SDR15C13-hydroxybutyrate dehydrogenase type 2 short chain dehydrogenase/reductase family 15C member 1 UCPA-OR UNQ6308; dehydrogenase/reductase (SDR family) member 6; Dehydrogenase/reductase SDR family member 6; Oxidoreductase UCPA; R-beta-hydroxybutyrate dehydrogenase; Short chain dehydrogenase/reductase family 15C member 1; short chain dehydrogenase/reductase family 15C, member 1
Gene Aliases: BDH2; DHRS6; EFA6R; PRO20933; SDR15C1; UCPA-OR; UNQ6308; UNQ6308/PRO20933
UniProt ID: (Human) Q9BUT1
Entrez Gene ID: (Human) 56898
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.