Novus Biologicals
Manufacturer Code:NBP15757420UL
Catalog # NBP15757420
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to BCKDK(branched chain ketoacid dehydrogenase kinase) The peptide sequence was selected from the N terminal of BCKDK. Peptide sequence CLPFIIGCNPTILHVHELYIRAFQKLTDFPPIKDQADEAQYCQLVRQLLD. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase, mitochondrial; BCKD-kinase; BCKDHKIN; BCKDHKIN branched chain alpha-ketoacid dehydrogenase kinase branched chain ketoacid dehydrogenase kinase EC 2.7.11 EC 2.7.11.4 mitochondrial; branched chain alpha-ketoacid dehydrogenase kinase; Branched-chain alpha-ketoacid dehydrogenase kinase
Gene Aliases: BCKDK; BCKDKD; BDK
UniProt ID: (Human) O14874
Entrez Gene ID: (Human) 10295
Molecular Function:
kinase
protein kinase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.