Novus Biologicals
Manufacturer Code:NBP186326
Catalog # NBP186326
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:QVAHFTFQPDPEPREYGQTQKMNLFQSVTSALDNSLAKDPTAVIFGEDVAFGGVFRCTVGLRD |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: 2-oxoisovalerate dehydrogenase beta subunit 2-oxoisovalerate dehydrogenase subunit beta mitochondrial BCKDE1B BCKDH E1-beta branched chain alpha-ketoacid dehydrogenase E1-beta subunit branched chain keto acid dehydrogenase E1 beta polypeptide Branched-chain alpha-keto acid dehydrogenase E1 component beta chain dJ279A18.1 E1B E1b-beta subunit of the branched-chain complex EC 1.2.4.4 FLJ17880; 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial; BCKDE1B; branched chain alpha-ketoacid dehydrogenase E1-beta subunit; branched chain keto acid dehydrogenase E1, beta polypeptide; Branched-chain alpha-keto acid dehydrogenase E1 component beta chain; E1b-beta subunit of the branched-chain complex; testis secretory sperm-binding protein Li 240mP
Gene Aliases: BCKDE1B; BCKDH E1-beta; BCKDHB; E1B
UniProt ID: (Human) P21953
Entrez Gene ID: (Human) 594
Molecular Function:
dehydrogenase
lyase
oxidoreductase
transferase
transketolase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.