Novus Biologicals
Manufacturer Code:NBP158142
Catalog # NBP158142
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to BCAT1(branched chain aminotransferase 1 cytosolic) The peptide sequence was selected from the N terminal of BCAT1. Peptide sequence MKDCSNGCSAECTGEGGSKEVVGTFKAKDLIVTPATILKEKPDPNNLVFG. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: BCAT(c); BCAT(c) BCATC BCT1PNAS121 branched chain amino-acid transaminase 1 cytosolic branched chain aminotransferase 1 cytosolic branched-chain-amino-acid aminotransferase cytosolic DKFZp686E12175 EC 2.6.1.42 ECA39 MECA39 placental protein 18 PP18 Protein ECA39; branched chain amino-acid transaminase 1, cytosolic; branched chain aminotransferase 1, cytosolic; Branched-chain-amino-acid aminotransferase, cytosolic; placental protein 18; Protein ECA39
Gene Aliases: BCAT1; BCATC; BCT1; ECA39; MECA39; PNAS121; PP18
UniProt ID: (Human) P54687
Entrez Gene ID: (Human) 586
Molecular Function:
transaminase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.