Novus Biologicals
Manufacturer Code:NBP256580
Catalog # NBP256580
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DSSDSSFSRSPPPGKQDSSDDVRRVQRREK |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: activating transcription factor B; B-ATF; B-cell-activating transcription factor; basic leucine zipper transcription factor ATF-like BATF1basic leucine zipper transcriptional factor ATF-like B-ATFSFA2 B-cell-activating transcription factor SFA-2activating transcription factor B SF-HT-activated gene 2 protein; basic leucine zipper transcription factor, ATF-like; Basic leucine zipper transcriptional factor ATF-like; SF-HT-activated gene 2 protein; SFA-2
Gene Aliases: B-ATF; BATF; BATF1; SFA-2; SFA2
UniProt ID: (Human) Q16520
Entrez Gene ID: (Human) 10538
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.