Novus Biologicals
Manufacturer Code:NBP159409
Catalog # NBP159409
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to BAT5(HLA-B associated transcript 5) The peptide sequence was selected from the middle region of BAT5. Peptide sequence RAKLLACDGNEIDTMFVDRRGTAEPQGQKLVICCEGNAGFYEVGCVSTPL. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: abhydrolase domain containing 16A BAT5G5 D6S82EEC 3.- HLA-B associated transcript 5 HLA-B-associated transcript 5 NG26protein BAT5 PP199 Protein G5; Abhydrolase domain-containing protein 16A; Alpha/beta hydrolase domain-containing protein 16A; hBAT5; HLA-B associated transcript 5; HLA-B-associated transcript 5; Monoacylglycerol lipase ABHD16A; Phosphatidylserine lipase ABHD16A; Protein G5
Gene Aliases: ABHD16A; BAT5; D6S82E; G5; NG26; PP199
UniProt ID: (Human) O95870
Entrez Gene ID: (Human) 7920
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.