Novus Biologicals
Manufacturer Code:NBP255462
Catalog # NBP255462
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EKYSPKELLALLKCVEAEIANYEACLKEEVEKRKKFKIDDQRRTHNYDEFICTFISMLAQEGMLANLVEQNISVRRRQGVSIGRLHKQRKP |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase); BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase) BRCA1-associated protein 1 Cerebral protein 6 cerebral protein-13 cerebral protein-6 DKFZp686N04275 EC 3.4.19.12 FLJ35406 FLJ37180 hucep-6 KIAA0272HUCEP-13 ubiquitin carboxyl-terminal hydrolase BAP1 ubiquitin carboxy-terminal hydrolase UCHL2; BRCA1-associated protein 1; Cerebral protein 6; cerebral protein-13; Ubiquitin carboxyl-terminal hydrolase BAP1
Gene Aliases: BAP1; HUCEP-13; hucep-6; KIAA0272; UCHL2
UniProt ID: (Human) Q92560
Entrez Gene ID: (Human) 8314
Molecular Function:
cysteine protease
hydrolase
protease
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.