Novus Biologicals
Manufacturer Code:NBP170418
Catalog # NBP170418
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to BAG3(BCL2-associated athanogene 3) The peptide sequence was selected from the middle region of BAG3. Peptide sequence NVTRPAAQPSFHQAQKTHYPAQQGEYQTHQPVYHKIQGDDWEPRPLRAAS. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
For Research Use Only
Protein Aliases: BAG family molecular chaperone regulator 3; BAG family molecular chaperone regulator 3 BAG-3 BAG-family molecular chaperone regulator-3 Bcl-2-associated athanogene 3 BCL2-associated athanogene 3 BCL2-binding athanogene 3 Bcl-2-binding protein Bis BIS CAIR-1 Docking protein CAIR-1 MGC104307; BAG-3; Bcl-2-associated athanogene 3; Bcl-2-binding protein Bis; BCL2-associated athanogene 3; BCL2-binding athanogene 3; Docking protein CAIR-1
Gene Aliases: BAG-3; BAG3; BIS; CAIR-1; MFM6
UniProt ID: (Human) O95817
Entrez Gene ID: (Human) 9531
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.