Novus Biologicals
Manufacturer Code:NBP162416
Catalog # NBP162416
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunocytochemistry (ICC) | Assay dependent |
Immunofluorescence (IF) | Assay dependent |
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to BACE1/beta-secretase 1 (beta-site APP-cleaving enzyme 1) The peptide sequence was selected from the N terminal of BACE1/beta-secretase 1 (NP_036236). Peptide sequence GQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSSTY. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: APP beta-secretase; APP beta-secretase ASP2 Aspartyl protease 2 BACEAsp 2 beta-secretase 1 beta-secretase 1 precursor variant 1 beta-site amyloid beta A4 precursor protein-cleaving enzyme Beta-site amyloid precursor protein cleaving enzyme 1 Beta-site APP cleaving enzyme 1 beta-site APP-cleaving enzyme beta-site APP-cleaving enzyme 1 EC 3.4.23 EC 3.4.23.46 FLJ90568 HSPC104 KIAA1149 Memapsin-2 Membrane-associated aspartic protease 2 transmembrane aspartic proteinase Asp2; asp 2; ASP2; Aspartyl protease 2; Beta-secretase 1; beta-secretase 1 precursor variant 1; beta-site amyloid beta A4 precursor protein-cleaving enzyme; Beta-site amyloid precursor protein cleaving enzyme 1; Beta-site APP cleaving enzyme 1; beta-site APP-cleaving enzyme 1; Memapsin-2; Membrane-associated aspartic protease 2; transmembrane aspartic proteinase Asp2
Gene Aliases: ASP2; BACE; BACE1; HSPC104; KIAA1149
UniProt ID: (Human) P56817
Entrez Gene ID: (Human) 23621
Molecular Function:
aspartic protease
hydrolase
protease
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.