Novus Biologicals
Manufacturer Code:NBP214344
Catalog # NBP214344
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Immunohistochemistry (IHC) | Assay dependent |
Immunohistochemistry (Paraffin) (IHC (P)) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MIQLTATPVSALVDEPVHIRATGLIPFQMVSFQASLEDENGDMFYSQAHY RANEFGEVDLNHASSLGGDYMGVH |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: BACAT; BACAT BATbile acid-CoA:amino acid N-acyltransferase bile acid CoA: amino acid N-acyltransferase (glycine N-choloyltransferase) bile acid Coenzyme A: amino acid N-acyltransferase (glycineN-choloyltransferase) EC 2.3.1.65 EC 3.1.2.2 FLJ20300 Glycine N-choloyltransferase Long-chain fatty-acyl-CoA hydrolase MGC104432; bile acid CoA: amino acid N-acyltransferase (glycine N-choloyltransferase); bile acid CoA:amino acid N-acyltransferase; bile acid Coenzyme A: amino acid N-acyltransferase (glycine N-choloyltransferase); Bile acid-CoA thioesterase; Bile acid-CoA:amino acid N-acyltransferase; Choloyl-CoA hydrolase; Glycine N-choloyltransferase; Long-chain fatty-acyl-CoA hydrolase
Gene Aliases: BAAT; BACAT; BAT
UniProt ID: (Human) Q14032
Entrez Gene ID: (Human) 570
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.