Novus Biologicals
Manufacturer Code:NBP16263320UL
Catalog # NBP16263320
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to B3GNT7(UDP-GlcNAc:betaGal beta-13-N-acetylglucosaminyltransferase 7) The peptide sequence was selected form the N terminal of B3GNT7. Peptide sequence QFLFYRHCRYFPMLLNHPEKCRGDVYLLVVVKSVITQHDRREAIRQTWGR. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: beta 1,3-N-acetylglucosaminyltransferase 7; beta 13-N-acetylglucosaminyltransferase 7 Beta-13-Gn-T7 Beta-13-N-acetylglucosaminyltransferase 7 beta3GnT7 Beta3Gn-T7 BGnT-7 EC 2.4.1 EC 2.4.1.- UDP-GlcNAc:betaGal beta-13-N-acetylglucosaminyltransferase 7; beta-1,3-Gn-T7; beta-1,3-N-acetylglucosaminyltransferase 7; beta3Gn-T7; BGnT-7; UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 7
Gene Aliases: B3GNT7; beta3GnT7
UniProt ID: (Human) Q8NFL0
Entrez Gene ID: (Human) 93010
Molecular Function:
glycosyltransferase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.