Novus Biologicals
Manufacturer Code:NBP168910
Catalog # NBP168910
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to B3gat2 (beta-13-glucuronyltransferase 2 (glucuronosyltransferase S)) The peptide sequence was selected from the C terminal of B3gat2. Peptide sequence SDFLKQITTVEELEPKASNCTKVLVWHTRTEKVNLANEPKYHLDTVNIEV. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Beta-1,3-glucuronyltransferase 2; Beta-13-glucuronyltransferase 2 beta-13-glucuronyltransferase 2 (glucuronosyltransferase S) EC 2.4.1.135 GlcAT-D GlcAT-S GLCATSgalactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 2 Glucuronosyltransferase S KIAA1963glcAT-D MGC138535 UDP-glucuronosyltransferase S UDP-glucuronyltransferase S uridine diphosphate glucuronic acid:acceptor glucuronosyltransferase; Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 2; GlcAT-D; GlcAT-S; glucuronosyltransferase S; UDP-glucuronosyltransferase S; UDP-glucuronyltransferase S; uridine diphosphate glucuronic acid:acceptor glucuronosyltransferase
Gene Aliases: B3GAT2; GLCATS; KIAA1963
UniProt ID: (Human) Q9NPZ5
Entrez Gene ID: (Human) 135152
Molecular Function:
glycosyltransferase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.