Novus Biologicals
Manufacturer Code:NBP16237620UL
Catalog # NBP16237620
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Human |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to B3GALTL(beta 13-galactosyltransferase-like) The peptide sequence was selected form the middle region of B3GALTL. Peptide sequence DYPKDYLSHQVPISFHKHWNIDPVKVYFTWLAPSDEDKARQETQKGFREE. |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: B3Glc-T B3GLCT B3GTLbeta3Glc-T beta 13-galactosyltransferase-like beta 3-glycosyltransferase-like beta-13-glucosyltransferase Beta3Glc-T beta-3-glycosyltransferase-like EC 2.4.1.- Gal-T UDP-GAL:beta-GlcNAc beta-13-galactosyltransferase-like; beta 1,3-galactosyltransferase-like; Beta 3-glucosyltransferase; beta 3-glycosyltransferase-like; Beta-1,3-glucosyltransferase; Beta-3-glycosyltransferase-like; Beta3Glc-T; UDP-GAL:beta-GlcNAc beta-1,3-galactosyltransferase-like
Gene Aliases: B3GALTL; B3Glc-T; B3GLCT; B3GTL; beta3Glc-T; Gal-T
UniProt ID: (Human) Q6Y288
Entrez Gene ID: (Human) 145173
Molecular Function:
glycosyltransferase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.