Novus Biologicals
Manufacturer Code:NBP169627
Catalog # NBP169627
Quantity:
TESTED APPLICATIONS | DILUTION |
---|---|
Western Blot (WB) | Assay dependent |
Species reactivity | Many |
Host / Isotype | Rabbit |
Class | Polyclonal |
Type | Antibody |
Immunogen | Synthetic peptides corresponding to B3GALT6(UDP-Gal:betaGal beta 13-galactosyltransferase polypeptide 6) The peptide sequence was selected from the N terminal of B3GALT6. Peptide sequence EREQARHGDLLLLPALRDAYENLTAKVLAMLAWLDEHVAFEFVLKADDDS |
Conjugate | Unconjugated |
Form | Liquid |
Purification | purified |
Storage buffer | PBS, pH7.4 |
Contains | 15mM sodium azide |
Storage conditions | Store at -20C. Avoid freeze-thaw cycles. |
Rabbit Polyclonal Antibody
For Research Use Only
Protein Aliases: Beta-1,3-galactosyltransferase 6; Beta-1,3-GalTase 6; beta-13-galactosyltransferase 6 Beta-13-GalTase 6 Beta3GalT6 Beta3Gal-T6 EC 2.4.1.134 Galactosyltransferase II Galactosylxylosylprotein 3-beta-galactosyltransferase UDP-Gal:betaGal beta 13-galactosyltransferase polypeptide 6GAG GalTII UDP-Gal:betaGlcNAc beta 13-galactosyltransferase polypeptide 6; beta3Gal-T6; GAG GalTII; Galactosyltransferase II; Galactosylxylosylprotein 3-beta-galactosyltransferase; UDP-Gal:betaGal beta 1,3-galactosyltransferase 6; UDP-Gal:betaGal beta 1,3-galactosyltransferase polypeptide 6; UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 6
Gene Aliases: B3GALT6; beta3GalT6; EDSP2; SEMDJL1
UniProt ID: (Human) Q96L58
Entrez Gene ID: (Human) 126792
Molecular Function:
glycosyltransferase
transferase
If an Invitrogen™ antibody doesn’t perform as described on our website or datasheet, we’ll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.